You are not registered with TradeKey.com. Please click here to register.
3,794,218  Registered Users
 
 Home > Sell Offers > Creative Peptides
Member Since Aug 2008
 

Creative Peptides

    
Sell Offers
Select and Click or or
  Showing 10 of 20 records found     Page 1 of 2
Contact Now
Desmopressin
Desmopressin (12/17/2009)
Desmopressin is used to prevent and control excessive thirst, urination, and dehydration caused by injury, surgery, and certain medical conditions, allowing you to sleep through the night without awakening to urinate. ...
[Related Categories: Pharmaceutical Chemicals]
[Related Keywords: adiuretin, ddavp, desmogalen, minirin, nocutil, octim, octostim, stimate]
 
Contact Now
Beta-Amyloid (1-42)
Beta-Amyloid (1-42) (12/17/2009)
Name Beta-Amyloid (1-42), human Catalog# 30-601-10 CAS No. 107761-42-2 Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln -Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-G...
[Related Categories: Bio-technology Products]
[Related Keywords: beta-amyloid (1-42)]
 
Contact Now
Bivalirudin
Bivalirudin (12/17/2009)
Bivalirudin has the potential to become an important anticoagulant during PCI procedures because of the reduced likelihood of severe bleeding as compared with standard therapy. Name Bivalirudin trifluoroacetate ...

[Related Keywords: angiomax, bg8967, hirulog]
 
Contact Now
Human beta Defensin 3(HBD-3)
Human beta Defensin 3(HBD-3) (12/17/2009)
Name: Human beta Defensin 3(HBD-3) Catalog Number: 40-202-03 Sequence: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41) [45AA] Purity: 95%(HPLC)

[Related Keywords: human beta defensin 3, hbd-3]
 
Contact Now
Leuprolide
Leuprolide (12/17/2009)
Name Leuprolide acetate Catalog# 10-101-22 CAS No. 53714-56-0 Sequence Pyr-His-Trp-Ser-Tyr-D-Leu-Leu-Arg-Pro-NHEt Molecular Formula C 59 H 84 N 16 O 12 Molecular Weight 1209.4 Pur...

[Related Keywords: a-43818, enantone, leuprorelin]
 
Contact Now
Somatostatin
Somatostatin (12/17/2009)
Name Somatostatin acetate Catalog# 10-101-32 CAS No. 38916-34-6 Sequence Ala-Gly-c[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys] (disulfide Cys3-Cys14) Molecular Formula C76H104N18O19S...

[Related Keywords: somatofalk, somatostatin-14, srih-14, stilamin]
 
Contact Now
Cetrorelix
Cetrorelix (12/17/2009)
Name Cetrorelix acetate Catalog# 10-101-09 CAS No. 120287-85-6 Sequence AC-D-Nal(2)-D-pCl-Phe-D-Pal(3)-Ser-Tyr-D-Cit-Leu-Arg-Pro -D-Ala-NH2 Molecular Formula C 70 H 92 Cl N 17 O 14 Mo...

[Related Keywords: cetrotide, sb75]
 
Contact Now
Thymopentin
Thymopentin (12/17/2009)
Name Thymopentin Catalog# 10-101-33 CAS No. 69558-55-0 Sequence Arg-Lys-Asp-Val-Tyr Molecular Formula C 30 H 49 N 9 O 9 Molecular Weight 679.8 Purity (HPLC) 98% min

[Related Keywords: tp-5, thymopoietin pentapeptide, timunox]
 
Contact Now
Gonadorelin
Gonadorelin (12/17/2009)
Name Gonadorelin acetate Catalog# 10-101-19 CAS No. 71447-49-9 Sequence Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly NH2 Molecular Formula C 55 H 75 N 17 O 13 Molecular Weight 1182.3 P...

[Related Keywords: cystorelin, dirigestran, factrel, gonadoliberin, luliberin]
 
Contact Now
Ghrelin
Ghrelin (12/17/2009)
Name Ghrelin Catalog# 30-601-09 CAS No. 258279-04-8 Sequence Gly-Ser-Ser(octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln -Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg-OH Mol...

[Related Keywords: gastric mltrp, motilin-related peptide, ppmtlrp]
 
  Page 1 of 2
Select and Click or or
 
^ Top
[1]  2  Next

[More Related Keywords: exenatide, desmopressin, bivalirudin, glucagon like peptide-1, bnp 32, pth 1-34, sermorelin, geref, exendin4, ghrh 1-44, ghrh, grf, abeta, 1-42, buserelin]
 
 
Premium Suppliers
zouping dongze imp&exp trading co, ltd [China]
Zouping dongze chemicals industry co., ltd is the largest and professional manufacturer of pharmaceutical materials in china .The main products include Benzocaine , Benzocaine hcl , BZP , TFMPP , Art...
Suzhou Howsine Biological Technology Co.,Ltd [China]
Suzhou Howsine Biological Technology Co., Ltd is a wholly owned subsidiary of Howsine Holdings Limited. Established in 2007. which is a research and development company specializing in customer synthe...
plantsman ltd. [China]
Plantsman Ltd is committed to the research & development, manufacturing and marketing for high purity of phytopharmaceuticals, peptides and other natural nutraceuticals, healthcare and cosmetic pr...